Bacterial taxon 155864
Locus Z0065
Protein AAG54361.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 250 aa, Gene n/a, UniProt n/a
>AAG54361.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKNPDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGVDMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINKITPKKIDTEEVATKQSTAEQITDNAIIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 64,059 | 0.17 | 0.15 | ○○○○○ 0.56 | 0.5601397532502597 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 64,044 | 0.3 | 0.15 | ○○○○○ 0.62 | 0.6167463494380307 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 64,054 | 0.95 | 0.12 | ○○○○○ 0.91 | 0.9105594757002673 | 21278291 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)