Bacterial taxon 155864
Locus Z0078
Protein AAG54373.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 189 aa, Gene n/a, UniProt n/a
>AAG54373.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEELWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFNELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFNGVVICGIDCLEVDLSNAETNNSRWYD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 80,961 | -4.06 | 0.073 | ●●○○○ -1.34 | -1.3354681227181062 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 80,857 | -1.92 | 0.17 | ●○○○○ -0.38 | -0.3770495213027416 | 21278291 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)