Bacterial taxon 155864
Locus Z0243
Protein AAG54512.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 266 aa, Gene n/a, UniProt n/a
>AAG54512.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQQLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKYYTVSTFSGIPDRQKPLTCNKNKDKNENEDVARAENMNWMQALRFVAAKGHQKAIIVYQDMLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYESRVIFPPAGITKTSNKELSNDHVTEAQLFNLKQKTYVSMVKDLVSRFQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 241,479 | 0.78 | 0.13 | ○○○○○ 0.84 | 0.8350716835338432 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 241,488 | 0.82 | 0.12 | ○○○○○ 0.85 | 0.8494943164692906 | 21278291 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)