Bacterial taxon 155864
Locus Z0392
Protein AAG54648.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 158 aa, Gene n/a, UniProt n/a
>AAG54648.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MLTASRYQNQIIRWLLRPLPGDMSDFWLLTARELSVLKILMQGMSFSEIARYEQRSSKTLHAIATRALMKLGLGTLSDFRLLYTGCGDSRVKRNIRLHARYVGQHSAHRLTQYVQNMVSGILYPEKVAVGESINSDAISGKVLPGQRKNISKKRPGLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 370,619 | -2.22 | 0.16 | ●○○○○ -0.51 | -0.5088141702728688 | 21278291 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)