Bacterial taxon 155864
Locus Z1098
Protein AAG55247.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 151 aa, Gene n/a, UniProt n/a
>AAG55247.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MIRVNFSKCLFHDCSMHGVKIKPWLPVKWTKELINDYLYGCLLSLYSICARDIYNMNAGNNVKVAADAFLEILYSLKNKYCIKLLSAQDRAFIYEFARMIFAYINDKSIEILLLSCFAAADQKAIQRYIPQAQDGEDFRNHLQYKLTLPTH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,036,881 | 1.98 | 0.07 | ○○○○○ 1.37 | 1.3721720272869835 | 21278291 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)