Bacterial taxon 155864
Locus Z2309
Protein AAG56362.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 125 aa, Gene n/a, UniProt n/a
>AAG56362.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MDERFINITPTSLSFKHADLSGLSYKNARLELALICPAIKSEVKISFDWIHSFRVTDEGDLLGMSGKQGINQTGIYRVANSTYLTWFTMQSCEIHKNKMIEHYVIATSNDVIDVLSTVSPQIVYD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,084,166 | -3.43 | 0.1 | ●●○○○ -1.05 | -1.0517894875239844 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,083,996 | -0.28 | 0.17 | ○○○○○ 0.36 | 0.3583726474009849 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)