Bacterial taxon 155864
Locus Z2560
Protein AAG56562.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 169 aa, Gene n/a, UniProt n/a
>AAG56562.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MDAFIVDPVQGELYSGLSHTELADIIRLADSVENQLNGGNSFLDVFSTYMGQVISEFMHSNDNRIELLQRRLHSCSFLVNIEEMSYIDEALQCPITLAIPQRGVFLRNAEGSRVCSLYDEMALSRIINDGMHHPLSREPITLSMLVAREQCEFDCSIGHFTVRSDCYSV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,273,012 | -5.42 | 0.027 | ●●○○○ -1.94 | -1.942853652263492 | 21278291 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)