Bacterial taxon 155864
Locus Z3921
Protein AAG57736.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 159 aa, Gene n/a, UniProt n/a
>AAG57736.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MSGNIGANLLDRLLGRENRMERRAVALERQLNGGVDFLRSVNNYFQSVMAEHRENKTSNKILMEKINSCVFGTDSNHFSCPESFLTCPITLDTPANGVFMRNSQGAEICSLYDKDTLVQLVETGGAHPLSREPITESMIMRKDECHFDSKKESFVASDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,549,661 | -3.01 | 0.12 | ●○○○○ -0.86 | -0.8616012062681297 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)