Bacterial taxon 155864
Locus Z4068
Protein AAG57866.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 178 aa, Gene n/a, UniProt n/a
>AAG57866.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MSIVKEEHKATLRKWHEELQEKRGERASLRRSTTVNDVCLTDGFRLFLKNRQIKWQDEPEWRITALALIAALSANVKAIDERLPFAAQLAAVMSKGRFTRLSAVKTPDELLRQLRRVVRLLNGSVNLDSLAEGVFRWCQESDDLLNHHRRHQRPTEFIRIRWALEYYQAGDVDNEQNQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,669,634 | -0.51 | 0.17 | ○○○○○ 0.26 | 0.25608363799384465 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)