Bacterial taxon 155864
Locus Z4289
Protein AAG58075.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 165 aa, Gene n/a, UniProt n/a
>AAG58075.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MKTSRLPIAIQQAVMRRLREKLAQANLKLGRNYPEPKLSYTQRGTSAGTAWLESYEIRLNPVLLLENSEAFIEEVVPHELAHLLVWKHFGRVAPHGKEWKWMMESVLGVPARRTHQFELQSVRRNTFPYSCKCQEHQLTVRRHNRVVRGEAVYRCVHCGEQLVAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,898,938 | -5.3 | 0.03 | ●●○○○ -1.89 | -1.890246455224073 | 21278291 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)