Bacterial taxon 155864
Locus Z5113
Protein AAG58826.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 203 aa, Gene n/a, UniProt n/a
>AAG58826.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MFSPMTMAGRSLVQATAQTLKPAVTRAAMQAGTGATGMRFMPVQSNFVINHGKLTNQLLQAVAKQTRNGDTQQWFQQEQTTYISRTVNRTLDDYCRSNNSVISKETKGHIFRAVENALQQPLDMNGAQSSIGHFLQSNKYFNQKVDEQCGKRVDPITRFNTQTKMIEQVSQEIFERNFSGFKVSEIKAITQNAILEHVQDTRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,671,508 | -3.99 | 0.077 | ●●○○○ -1.3 | -1.2999094352653981 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,671,597 | -0.57 | 0.17 | ○○○○○ 0.23 | 0.23124347150159297 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)