Bacterial taxon 155864
Locus Z5474
Protein AAG59122.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 238 aa, Gene n/a, UniProt n/a
>AAG59122.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MRYVILLILWIITVFLSHLQHSNLLTGDPGMVGEYIGSVLLGPLLLPVLVSGILCTFTKKTRNFASFTRGCCWVLGVLLLSNVGNTFRLFTPWHYTFEKAAISVTVPNRHWNTVSISTDKTIDIRSEDNSVFISAFRLPAGRSADDSLEELKKMQRDNLKDQYNEETFQFHDCNAKHFTCKYQDVLINFDGQQKRTISVYLEDTPRAVGIIALMEPDTADKYRQQAMEIMLSAKNTVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,987,982 | 1.61 | 0.086 | ○○○○○ 1.21 | 1.2061728040730608 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)