Bacterial taxon 155864
Locus Z5475
Protein AAG59123.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 228 aa, Gene n/a, UniProt n/a
>AAG59123.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MDVFMQNIILLFIYLLLIAVNHFRYKFLLSGNAGEMILYFANVFFNPLALSFIIATIICITIKKRSSRSFIRGTCWLMGLFLIYSSYTVWERHSIWDYTFPEPGITVTVPSKQWVANIVKQGPTLVTRDAHAILAIVAFSQNELGVHSIEELTATQNGTAEMHVCDVQGFACAYQEGVQTMSDGKVRHAIFMTLLDNTNLIQLVAAIDPDYLDEYQEEVMKMMLSARQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,988,690 | -3.92 | 0.08 | ●●○○○ -1.27 | -1.271714389118485 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,988,640 | 0.97 | 0.12 | ○○○○○ 0.92 | 0.9166775303078426 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,988,811 | 1.23 | 0.1 | ○○○○○ 1.03 | 1.0332110151404796 | 21278291 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)