Bacterial taxon 155864
Locus Z5791
Protein AAG59380.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 132 aa, Gene n/a, UniProt n/a
>AAG59380.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVIPLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAALAGGIFNAACMTW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,295,872 | -1.83 | 0.17 | ●○○○○ -0.33 | -0.3331526379854693 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,295,855 | 1.52 | 0.091 | ○○○○○ 1.17 | 1.1661311549122346 | 21278291 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)