Bacterial taxon 155864
Locus Z5895
Protein AAG59481.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 235 aa, Gene n/a, UniProt n/a
>AAG59481.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MDKIIGKQLPKKDQDNEHWVSMSDLMAGLMMVFMFISIAYMHYVRIEKEKIKEVAVAYENAQLQLYNALDIEFAKDLQDWDAEIDKQTLEVRFKSPDVLFGLGSTELKPKFKLILDDFFPRYLKVLDNYQEHITEVRIEGHTSTDWTGTTNPDIAYFNNMALSQGRTRAVLQYVYDIKNIATHQQWVKSKFAAVGYSSAHPILDKTGKEDPNRSRRVTFKVVTNAELQIRKIIQE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,391,840 | 1.52 | 0.09 | ○○○○○ 1.17 | 1.1665908357855836 | 21278291 |
Retrieved 1 of 1 entries in 0.2 ms
(Link to these results)