Bacterial taxon 155864
Locus Z0005
Protein AAG54305.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 98 aa, Gene n/a, UniProt n/a
>AAG54305.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,395 | -3.09 | 0.12 | ●○○○○ -0.9 | -0.9001721019962553 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,538 | -1.19 | 0.18 | ●○○○○ -0.05 | -0.04658693849129284 | 21278291 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)