Bacterial taxon 155864
Locus Z0295
Protein AAG54559.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 150 aa, Gene n/a, UniProt n/a
>AAG54559.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MNNIQIRNYQPGDFQQLCAIFIRAVMMTASQHYSPQQIAAWAQIDESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPWIKSESELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFSMRYKPQH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 290,862 | 1.21 | 0.11 | ○○○○○ 1.03 | 1.0254748642375737 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 290,677 | 1.45 | 0.094 | ○○○○○ 1.13 | 1.1339614658754515 | 21278291 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)