Bacterial taxon 155864
Locus Z0408
Protein AAG54663.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 287 aa, Gene n/a, UniProt n/a
>AAG54663.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEYDNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNFRLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASAVASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITLEAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTYGGNYVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 388,225 | -4.21 | 0.067 | ●●○○○ -1.4 | -1.3991342689026867 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 387,776 | -2.08 | 0.16 | ●○○○○ -0.45 | -0.4490854618313216 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 387,922 | -0.39 | 0.17 | ○○○○○ 0.31 | 0.3092969351161424 | 21278291 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)