Bacterial taxon 155864
Locus Z0664
Protein AAG54866.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 92 aa, Gene n/a, UniProt n/a
>AAG54866.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MNRPAILKKKAAKDVASVLKIIFLFYFFLIARLKQRYSIREIKRDLWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPIM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 630,040 | 0.36 | 0.14 | ○○○○○ 0.65 | 0.6455466712426279 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 629,949 | 1.4 | 0.096 | ○○○○○ 1.11 | 1.112062311828675 | 21278291 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)