Bacterial taxon 155864
Locus Z1006
Protein AAG55158.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 237 aa, Gene n/a, UniProt n/a
>AAG55158.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MESYLQNSNKLDFQHETRILNGIWLITALGLVATAGLAWGAKYLEITATKYDSPPMYVAIGLLLLCMYGLIKDINKINAAIAGVIYLFLLSLVAIVVASLVPVYAIIVVFSTAGAMFLISMLAGLLFNIDPGSHRFMIMMTLTGLALVIIVNAALMSERPIWVISCLMIVLWSGIILHGRNKLLELAGKCHSEELWSPVRCAFTGALTLYYYFIGFFGILAAIAITLVWQRHTRFFH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 945,242 | -2.21 | 0.16 | ●○○○○ -0.5 | -0.5047360094483003 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 944,918 | -0.56 | 0.17 | ○○○○○ 0.23 | 0.23455810410407274 | 21278291 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)