Bacterial taxon 155864
Locus Z2435
Protein AAG56467.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 316 aa, Gene n/a, UniProt n/a
>AAG56467.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MAMYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAMRQGVISQRTAWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHDRLEAVIFTPTDWHLLRKCPSPVWMVKDQPWPEGGKALVAVNLASEEPYHNALNEKLVKETIELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINENMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIKPDQYQTPVELDDEEDD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,180,532 | -2.69 | 0.14 | ●○○○○ -0.72 | -0.7220248932314265 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,180,549 | 0.4 | 0.14 | ○○○○○ 0.66 | 0.6647734064740698 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)