Bacterial taxon 155864
Locus Z2863
Protein AAG56809.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 152 aa, Gene n/a, UniProt n/a
>AAG56809.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYNNVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDGVLVMQLEQRRLLIRVRNIDDLERIYKLLVSTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,582,044 | -4.81 | 0.044 | ●●○○○ -1.67 | -1.6704772290190735 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)