Bacterial taxon 155864
Locus Z3022
Protein AAG56947.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 159 aa, Gene n/a, UniProt n/a
>AAG56947.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MFTIKTDDLTHPAVQALVAYHISGMLQQSPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELKSMRTAPNYLRRGVASLILRHILQVAHDRCLHRLSLETGTQAGFTACHQLYLKHGFVDCEPFADYQLDPHSRFLSLTLCEDNELL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,708,806 | 0.02 | 0.16 | ○○○○○ 0.49 | 0.49470619455978215 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,708,381 | 1.03 | 0.11 | ○○○○○ 0.95 | 0.9456486801932762 | 21278291 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)