Bacterial taxon 155864
Locus Z3964
Protein AAG57773.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 149 aa, Gene n/a, UniProt n/a
>AAG57773.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MGLFNFVKDAGEKLWDAVTGQHDKXDQAKKVQEHLSKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,586,215 | -1.52 | 0.18 | ●○○○○ -0.2 | -0.19581633453593136 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,585,926 | 1.15 | 0.11 | ○○○○○ 1 | 0.9982692173882345 | 21278291 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)