Bacterial taxon 155864
Locus Z4296
Protein AAG58082.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 234 aa, Gene n/a, UniProt n/a
>AAG58082.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,904,166 | -0.33 | 0.17 | ○○○○○ 0.33 | 0.3347393576670988 | 21278291 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)