Bacterial taxon 155864
Locus Z4517
Protein AAG58292.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 167 aa, Gene n/a, UniProt n/a
>AAG58292.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,110,318 | 1.11 | 0.11 | ○○○○○ 0.98 | 0.9811563016600781 | 21278291 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)