Bacterial taxon 155864
Locus Z4809
Protein AAG58550.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 158 aa, Gene n/a, UniProt n/a
>AAG58550.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MIRHAETRDYEAIRQIHAQPEVYYNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDARWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKFGFEIEGTGKKYALRNGEYVDAYFMARVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,368,003 | -0.07 | 0.16 | ○○○○○ 0.45 | 0.451060499878706 | 21278291 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)