Bacterial taxon 155864
Locus Z5467
Protein AAG59115.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 99 aa, Gene n/a, UniProt n/a
>AAG59115.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,981,836 | -2.2 | 0.16 | ●○○○○ -0.5 | -0.5010066005960769 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,981,724 | -1.32 | 0.18 | ●○○○○ -0.11 | -0.10744492441169522 | 21278291 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)