Bacterial taxon 155864
Locus Z5859
Protein AAG59446.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 60 aa, Gene n/a, UniProt n/a
>AAG59446.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MILEGNCRSVSIIADISCFFLFHFHAIRYAFYSIHPTYRAECENERLTLLLTAQGCALSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,358,351 | -0.61 | 0.17 | ○○○○○ 0.21 | 0.2096651360895246 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,358,344 | 0.58 | 0.14 | ○○○○○ 0.75 | 0.7454049206832138 | 21278291 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)