Bacterial taxon 155864
Locus Z5907
Protein AAG59493.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 241 aa, Gene n/a, UniProt n/a
>AAG59493.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MKFMKKAKILSGVLLLCFSSPLISQAATLDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTIHDNKKENAALNDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,423,860 | -0.6 | 0.17 | ○○○○○ 0.22 | 0.21631063417244575 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,423,789 | 1.2 | 0.11 | ○○○○○ 1.02 | 1.023460540894304 | 21278291 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)