Bacterial taxon 155864
Locus Z6020
Protein AAK16936.1
orf, hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 189 aa, Gene n/a, UniProt n/a
>AAK16936.1|Escherichia coli O157:H7 str. EDL933|orf, hypothetical protein
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNNELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSLKVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLTYNKGSLQCG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,281,440 | -0.42 | 0.17 | ○○○○○ 0.29 | 0.2946162455843674 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,281,060 | 1.1 | 0.11 | ○○○○○ 0.98 | 0.9769496702795835 | 21278291 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)