Bacterial taxon 155864
Locus Z5944
Protein AAG59527.1
orf; conserved hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 387 aa, Gene n/a, UniProt n/a
>AAG59527.1|Escherichia coli O157:H7 str. EDL933|orf; conserved hypothetical protein
MALGKESDKSLATAFQDLRELKVDVAYPFLLALYHDYKNDDLSHEDFLSIIRLIESYVFRRAVCAIPTNSLNKTFATFYKVINKEKYLESIQVHFLNLPSYRRFPNDDEFKRELKVRDLYNFRSRSYWLRRLENDKRRERVEEFTIEHIMPQNENLSAKWREELGSDWQRIHKELLHTLGNLTLTRYNSRYSDRPFAEKRDIEDGFKHSPLYLNIGLGQCEKWDEAAIHARADRLAELAVQVWQAPSLPEEVLAVYRGQPENKTSYSLSDYPFLADGSHSRVLFDHLRDEIMRLDAGITQEVLKLYIAFKAETNFVDVVPQKSRLRLSLNMQFHELVDPKGIAKDVTNVGRWGNGDVEIGFSDLAQLPYIMGLIRQAFEKQMESALV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,466,480 | -2.91 | 0.13 | ●○○○○ -0.82 | -0.8203102032352849 | 21278291 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)