Bacterial taxon 155864
Locus Z4090
Protein AAG57888.1
orf; hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 164 aa, Gene n/a, UniProt n/a
>AAG57888.1|Escherichia coli O157:H7 str. EDL933|orf; hypothetical protein
MNQYQRRADLIPNLVASIKGYSSHERDVLEAVTLARSQANRASSDXQQTPGDEQKLQAWQQAQAQVTRTLGQLTIISERYPELKSQELYQNLMVQLEGSENRIAVARGRYIKAIEQYNVTIRKFPAVLTAKVMDYTPKKNYLPDDVAAVSKAPTIDFSQNANAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,693,089 | -4.51 | 0.055 | ●●○○○ -1.54 | -1.536028551569855 | 21278291 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)