Bacterial taxon 155864
Locus Z4091
Protein AAG57889.1
orf; hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 232 aa, Gene n/a, UniProt n/a
>AAG57889.1|Escherichia coli O157:H7 str. EDL933|orf; hypothetical protein
MLIKRGSSMRNFIFLMAFFCSSVFATQIPVPESPKYVNDLTGTLTNSEVNTLTNQIKALTQKNYAQLVVLVVETTGDETIEQYATRVFDSWKPGDKDRDDGVLLLVAWQDHTVRIEIGYGLEGIITDAQSGKIIRNSIIPAFKKGDLAGGLQKGISDIESRLTGNNLATITPTDHPLPFSGWWALLVWAIVLTFISARGYIKTLGVICFAAIVLAFVLPIAGFSGSWGVLAT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,693,929 | -5.68 | 0.022 | ●●●○○ -2.06 | -2.058196640676001 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,693,854 | -1.88 | 0.17 | ●○○○○ -0.36 | -0.35746361298345714 | 21278291 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)