Bacterial taxon 155864
Locus Z4915
Protein AAG58645.1
orf; hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 164 aa, Gene n/a, UniProt n/a
>AAG58645.1|Escherichia coli O157:H7 str. EDL933|orf; hypothetical protein
MSHVSLQEFLKTEPDGTLEVVAEQYNTTLLEVVRNLPSSTVVPGDKFDTVWDTVCEWGNVTTLVHTADVILEFSGELPSGFHRHGYFNLRGKHGMSGHIKAENCTHIALIERKFMGMDTASILFFNKEGSAMLKIFLGRDDHRQLLSEQVSAFHTLAASLKEHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,461,761 | -2.57 | 0.14 | ●○○○○ -0.67 | -0.666280034137057 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)