Bacterial taxon 155864
Locus Z0311
Protein AAG54573.1
partial O replication protein for prophage CP-933H
Escherichia coli O157:H7 str. EDL933
Length 202 aa, Gene n/a, UniProt n/a
>AAG54573.1|Escherichia coli O157:H7 str. EDL933|partial O replication protein for prophage CP-933H
MTNTAKILNFGRGNFAGQERNVADLDDGYARLSNMLLEAYSGADLTKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGGMFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSNWGIAIPQNRGTQKTLLQKKKEKIIRPRILANPLTSQKTIFLWLNRMLQFRAAASGEQQKT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 303,537 | 1.1 | 0.11 | ○○○○○ 0.98 | 0.9780533546472294 | 21278291 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)