Bacterial taxon 155864
Locus Z5462
Protein AAG59110.1
periplasmic sulfate-binding protein
Escherichia coli O157:H7 str. EDL933
Length 329 aa, Gene n/a, UniProt n/a
>AAG59110.1|Escherichia coli O157:H7 str. EDL933|periplasmic sulfate-binding protein
MNKWGVGLTFLLAATSVMAKDIQLLNVSYDPTRELYEQYNKAFSAHWKQQTGDNVVIRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKEWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKLGVSVITPNPKSSGGARWNYLAAWGYALHHNNNDQAKAQDFVRALYKNVEVLDSGARGSTNTFVERGIGDVLISWENEALLAANELGKDKFEIVTPSESILAEPTVSVVDKVVEKKGTKEVAEAYLKYLYSPESQEIAAKNYYRPRDAXVAKKYENAFPKLKLFTIDEEFGGWTKAQKEHFANGGTFDQISKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,978,328 | -3.1 | 0.12 | ●○○○○ -0.9 | -0.9020939930747236 | 21278291 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)