Bacterial taxon 155864
Locus Z3041
Protein AAG56966.1
positive regulator for ctr capsule biosynthesis, positive transcription factor
Escherichia coli O157:H7 str. EDL933
Length 207 aa, Gene n/a, UniProt n/a
>AAG56966.1|Escherichia coli O157:H7 str. EDL933|positive regulator for ctr capsule biosynthesis, positive transcription factor
MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,723,852 | -3.07 | 0.12 | ●○○○○ -0.89 | -0.8919483000163455 | 21278291 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)