Bacterial taxon 155864
Locus Z0041
Protein AAG54338.1
possible synthesis of cofactor for carnitine racemase and dehydratase
Escherichia coli O157:H7 str. EDL933
Length 203 aa, Gene n/a, UniProt n/a
>AAG54338.1|Escherichia coli O157:H7 str. EDL933|possible synthesis of cofactor for carnitine racemase and dehydratase
MERTLTTVSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRGDYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIMDGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLVGRCHASLHETQPLRQMEENRPRLQGTTDVTPKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 39,327 | -2.39 | 0.15 | ●○○○○ -0.59 | -0.5855539272906238 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 39,338 | -1.78 | 0.17 | ●○○○○ -0.31 | -0.31315231955429956 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)