Bacterial taxon 155864
Locus Z4142
Protein AAG57936.1
prepilin peptidase dependent protein B
Escherichia coli O157:H7 str. EDL933
Length 187 aa, Gene n/a, UniProt n/a
>AAG57936.1|Escherichia coli O157:H7 str. EDL933|prepilin peptidase dependent protein B
MPVKEQGFSLLEVLIAMAISSVLLLGAARFLPALQRESLTSTRKLALEDEIWLRVFTVAKHLQRAGYCHGICTGEGLEIVGQGDCIIVQWDANSNGIWDREPVKESDQIGFRLKEQVLETLRGATSCEGKGWDKVTNPDAIIIDTFQVVRQDVSGFSPVLTVNMRAASKSEPQTVVDASYSVTGFNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,753,301 | -4.61 | 0.051 | ●●○○○ -1.58 | -1.5794635893867697 | 21278291 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)