Bacterial taxon 155864
Locus Z2404
Protein AAG56444.1
prophage CP-933R superinfection exclusion protein
Escherichia coli O157:H7 str. EDL933
Length 203 aa, Gene n/a, UniProt n/a
>AAG56444.1|Escherichia coli O157:H7 str. EDL933|prophage CP-933R superinfection exclusion protein
MRLRVVPGFISPPPGFGGLGYTPTARACVNISIPLQLRVIDMLDVFTPLLKLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFSFVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKKLERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRRFNR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,159,141 | -0.13 | 0.16 | ○○○○○ 0.43 | 0.42605350928728103 | 21278291 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)