Bacterial taxon 155864
Locus Z4492
Protein AAG58270.1
PTS system, cytoplasmic, N-acetylgalactosamine-specific IIB component 1 (EIIB-AGA)
Escherichia coli O157:H7 str. EDL933
Length 158 aa, Gene n/a, UniProt n/a
>AAG58270.1|Escherichia coli O157:H7 str. EDL933|PTS system, cytoplasmic, N-acetylgalactosamine-specific IIB component 1 (EIIB-AGA)
MSSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,093,221 | -5.57 | 0.024 | ●●●○○ -2.01 | -2.010101874903364 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,092,942 | -1.73 | 0.17 | ●○○○○ -0.29 | -0.29129901382583206 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,092,991 | 0.44 | 0.14 | ○○○○○ 0.68 | 0.682883463125947 | 21278291 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)