Bacterial taxon 155864
Locus Z4009
Protein AAG57810.1
PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components; frag
Escherichia coli O157:H7 str. EDL933
Length 216 aa, Gene n/a, UniProt n/a
>AAG57810.1|Escherichia coli O157:H7 str. EDL933|PTS system, glucitol/sorbitol-specific IIB component and second of two IIC components; frag
MEDIYVSGVKEENITVVGDATPQPSSVGRDYDTSKKITEQSDGLLAKVGMGMGSAVAVLFQSGRDTIDTVLKTILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVMLALICSFPLLSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEARZDTVRVGVPSVLVSRFLTGAPTVLIAWFVSGFIYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,617,988 | -5.6 | 0.023 | ●●●○○ -2.02 | -2.02257571828341 | 21278291 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)