Bacterial taxon 155864
Locus Z3002
Protein AAG56929.1
putative 2-component transcriptional regulator
Escherichia coli O157:H7 str. EDL933
Length 218 aa, Gene n/a, UniProt n/a
>AAG56929.1|Escherichia coli O157:H7 str. EDL933|putative 2-component transcriptional regulator
MINVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRANAVDVVLMDMSMPGIGGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDIAQQMALSQIEPEKTESPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNIHGDVELTHLAIRHGLCNAETLSSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,692,766 | -0.09 | 0.16 | ○○○○○ 0.44 | 0.44338722820056164 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,692,702 | -0 | 0.16 | ○○○○○ 0.48 | 0.4829768969932535 | 21278291 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)