Bacterial taxon 155864
Locus Z4176
Protein AAG57968.1
putative 2-component transcriptional regulator
Escherichia coli O157:H7 str. EDL933
Length 148 aa, Gene n/a, UniProt n/a
>AAG57968.1|Escherichia coli O157:H7 str. EDL933|putative 2-component transcriptional regulator
MMGAELVKWVKSHKIDAHIITFVAKMPYIDSIKLLEAGAKGCVWKTSHPAKLNRAIDSISNGYTYFDSVHMDCEKISSRYSSDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELIKTALRMGVCTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,784,443 | -1.52 | 0.18 | ●○○○○ -0.2 | -0.19824113449123265 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)