Bacterial taxon 155864
Locus Z1442
Protein AAG55569.1
putative antitermination protein N of bacteriophage BP-933W
Escherichia coli O157:H7 str. EDL933
Length 127 aa, Gene n/a, UniProt n/a
>AAG55569.1|Escherichia coli O157:H7 str. EDL933|putative antitermination protein N of bacteriophage BP-933W
MTRRTQFKGNSRSRRRERLKAKALANGVLAREEAISSEVLHRPTLSRAQIQAKGTHETPERIEDAKPIKFMAQDVIWQQKEYRRNLERAAIVYANEFGHKQPETGVCLPNVAIYAAGYRKSKQLTAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,339,895 | -4.37 | 0.061 | ●●○○○ -1.47 | -1.470152985984239 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,340,001 | 0.59 | 0.14 | ○○○○○ 0.75 | 0.7476660060348919 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)