Bacterial taxon 155864
Locus Z0376
Protein AAG54633.1
putative AraC-like transcriptional regulator
Escherichia coli O157:H7 str. EDL933
Length 296 aa, Gene n/a, UniProt n/a
>AAG54633.1|Escherichia coli O157:H7 str. EDL933|putative AraC-like transcriptional regulator
MRYDKELTENVMIRQKILQQLLEWIECNLEHPISIEDIAQKSGYSRRNIQLLFRNFMHVPLGEYIRKRRLCRAAILVRLTAKSMLDIAISLHFDSQQSFSREFKKLFGCSPRVYRHRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNKSPDEEVKLRRHHLARCMKNFKTDTYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPKEWTINRGLYASFRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNEDFVEKDSNDVVCEIFIPVRPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 359,130 | -4.43 | 0.058 | ●●○○○ -1.5 | -1.499992626175568 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 358,416 | -4.01 | 0.076 | ●●○○○ -1.31 | -1.309746996514146 | 21278291 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)