Bacterial taxon 155864
Locus Z0321
Protein AAG54582.1
putative AraC-type regulatory protein encoded in prophage CP-933H
Escherichia coli O157:H7 str. EDL933
Length 247 aa, Gene n/a, UniProt n/a
>AAG54582.1|Escherichia coli O157:H7 str. EDL933|putative AraC-type regulatory protein encoded in prophage CP-933H
MATTCSVILILESFDVYFGKESVFLERGSSVLVDSSSRDFFLTYPERVIVADFGAEFISRYLKANNLRDISDCREYPSYLKINFADFSLIKGLISWANHCAEYIEIFDESIAFTCLSAFSSEKQFGVFLFGCLKSTGAKVKTIIHTDLSAPWRLKDISSRLYLSESLLKRKLKEEGVSFSKIILDERMQMAEYLLSTRCYPISKVAKVCGYASVSYFTYVFRRYFGVSPSQYSQRSSESKILTHQGI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 309,235 | 0.12 | 0.15 | ○○○○○ 0.54 | 0.5364460975328802 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)