Bacterial taxon 155864
Locus Z4919
Protein AAG58648.1
putative ATP-binding protein of ABC transport system
Escherichia coli O157:H7 str. EDL933
Length 256 aa, Gene n/a, UniProt n/a
>AAG58648.1|Escherichia coli O157:H7 str. EDL933|putative ATP-binding protein of ABC transport system
MISAQNXVYSLQGRRLTDNVSLTFPGGEIVAILGPNGAGKSTLLRQLTGYLQPDSGECRLFNKPLNEWSITELAKHRAVMRQNSHMAFPFSVQEVIQMGRHPHRTGNQDNETAQIMALCDCQALANRDYRQLSGGEQQRVQLARLLVQLWEPTPSPKWLFLDEPTSALDIHHQQHLFRLLRQLVHERQFNVCCILHDLNLAAHYADRVVLMQKGKVIANGKPQDVLTQQALTMLYGADITVLKDPANHSPLIVLDH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,464,164 | -1.55 | 0.17 | ●○○○○ -0.21 | -0.20920367118580793 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)