Bacterial taxon 155864
Locus Z1287
Protein AAG55424.1
putative chaperone
Escherichia coli O157:H7 str. EDL933
Length 233 aa, Gene n/a, UniProt n/a
>AAG55424.1|Escherichia coli O157:H7 str. EDL933|putative chaperone
MKTCITKGIVTVSLTAILLSCSSTWAAGKGGVGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKREEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKLVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,217,285 | 0.75 | 0.13 | ○○○○○ 0.82 | 0.8194156857827313 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)